Image
LifeFormulae, LLC
9119 Highway 6 South #228
Missouri City, TX 77459
(713) 472-6700  
 

LARTS Online GenBank example for amidohydrolase

>gi|154425851|gb|BC151478.1| Bos taurus amidohydrolase domain containing 2, mRNA (cDNA clone MGC:179382 IMAGE:8558625), complete cds
GTGGGCGCCTCCGGCTCGGCTGGGCTCAGGATGCGCGGCGGGCAGGGCGCGGCGCGGGCC
CCGGTGATCCAGTTCACCAACTGCCGCATCTTGAGGGGTGGCGCGCTGCTCAGGGAGGAC
CTCTGGGTGCGCGGGGGCCGCATCCTGGACCCGGAGAAGCTGTTCTTTGAGGAGCGGCGC
GTGGCTGACGAGCAGCGGGACTGCGGCGGCTGCATCTTGGCGCCCGGCTTCATCGACGTG
CAGATCAACGGTGGATTTGGCGTTGACTTCTCACAAGCCTCGGAGGACGTGGGTTCGGGG
GTTGCCCTAGTGGCCCGGAGGATCCTGTCGCATGGAGTCACCTCTTTCTGCCCCACGTTG
GTCACATCGCCACTGGAGGTTTATCACAAGGTCCTTCCTCAGATCCCTGTGAAGAGTGGT
GGTCCCCATGGGGCAGGGGTCCTCGGGGTGCACCTGGAGGGCCCATTCATCAGCCGGGAG
AAGCGGGGCGCGCACCCCGAGGCCCACCTGCGCTCCTTTGAAGCTGACGCTTTCCAAGAC
GTGCTGGCCACCTACGGGGGCCTGGACAATGTCCGCATCGTGACGCTGGCCCCCGAGCTG
GGCCACAGCCAGGAGGTGATCCGGGCGCTGACGGCCCTCGGCATCTGCGTGTCCTTAGGG
CACTCGGTGGCTGACCTGGGGACTGCGGAGGAAGCCGTGCAGAGTGGGGCCACCTTCATC
ACCCACCTCTTCAACGCCATGCTGCCTTTCCACCACCGCGACCCAGGCATCGTGGGGCTC
CTGACCAGCGATCGGCTGCCTGCAGGCCGTCATATTTTCTACGGGATGATTGCTGACGGT
ATACACACCAACCCGGCCGCCCTGCGCATCGCCCACCGGGCCCATCCCAAGGGGCTGGTG
CTAGTCACTGATGCTGTCCCTGCACTGGGCTTGGGCAACGGCCGACACACGCTGGGGCAG
CAGGAGGTGGAGGTGGATGGGCTGACAGCTTATGTGGCAGGCACCAACACACTGAGCGGC
AGCATCGCCCCGATGGACACCTGCGTGCGGCACTTCCTGCAGGCCACAGGCTGCAGTGTG
GAGTCCGCTCTGGAGGCTGCGTCCCTGCATCCAGCACAGCTGCTGGGGCTGGAGAAGCGC
AAGGGGACCCTGGACTTCGGGGCTGACGCAGACTTCGTGGTGCTCGACGACTCTCTTCAC
GTCCGGGCCACCTACATCTCGGGCGAGCTGGTGTGGCAGGTGGAGGAGGCCAGGCCGTGA
CCCAGGACCACCGCTGGAGGGGATGCCCAGCCCCAGCTGGACACTGTCGGTTGGGCATTG
GGGAGCTGGTCTCAAGAGAGAGGAGGGAGCCTCGGCCCAGGTGGAGGCCTCAGCCCGGAG
TCGGCGGCTTGGATAAACATGTGCCCCGTAGGGAAAAAAAAAAAAAAAA
>gi|154425852|gb|AAI51479.1| AMDHD2 protein [Bos taurus]
MRGGQGAARAPVIQFTNCRILRGGALLREDLWVRGGRILDPEKLFFEERRVADEQRDCGG
CILAPGFIDVQINGGFGVDFSQASEDVGSGVALVARRILSHGVTSFCPTLVTSPLEVYHK
VLPQIPVKSGGPHGAGVLGVHLEGPFISREKRGAHPEAHLRSFEADAFQDVLATYGGLDN
VRIVTLAPELGHSQEVIRALTALGICVSLGHSVADLGTAEEAVQSGATFITHLFNAMLPF
HHRDPGIVGLLTSDRLPAGRHIFYGMIADGIHTNPAALRIAHRAHPKGLVLVTDAVPALG
LGNGRHTLGQQEVEVDGLTAYVAGTNTLSGSIAPMDTCVRHFLQATGCSVESALEAASLH
PAQLLGLEKRKGTLDFGADADFVVLDDSLHVRATYISGELVWQVEEARP
 
 
LifeFormulae, LLC ©    Home  |  Contact Us  |  Site Map  |  Privacy Policy | LifeFormulae Blog