Image
LifeFormulae, LLC
9119 Highway 6 South #228
Missouri City, TX 77459
(713) 472-6700  
 

LARTS Online GenBank example for aldolase

>gi|148745534|gb|BC142385.1| Bos taurus aldolase B, fructose-bisphosphate, mRNA (cDNA clone MGC:159510 IMAGE:8177098), complete cds
GAGAGCTGCGCCGTGGGAGGTGAGGCTTCCGCGCGCGTCCAAATCCTGCGGCTGCCGCTC
CTCCGAGGCCTCAAGGTCCAGCGATGGCTCCTCCGTGGTCATGAGCCAGACAGCCTAGGC
GACTTCGGCAGTGGCCGTCAGCGTGCTCAGAGAACCGAGCTGACCGCTCTCACCCGACCT
GTCACCATGGCCCACCAGTTTCCAGCCCTCACTTCAGAACAGAAGAAGGCACTCTCAGAA
ACTGCCCGACGCATTGTTGCCAATGGGAAGGGGATCCTGGCTGCAGATGAGTCCGTAGGC
ACGATGGGGAACCGCCTGCAAAGGATCAAGGTGGAGAACACGGAAGAGAACCGCCGGCAG
TTCCGCGAACTCCTCTTCACTGTGGACAGCTCCATCAGCCAGAGCATCGGGGGTGTGATC
CTCTTCCATGAGACCCTCTACCAGAAGGACGGCCAGGGAAAACTGTTCAGAGACATCCTC
AAGGAAAAAGGGATCGTGGTGGGAATCAAGTTAGATCAAGGAGTTGCTCCGCTTGCAGGA
ACAAACAAAGAAACCACCGTTCAAGGGCTTGATGGCCTTTCTGAACGCTGTGCTCAGTAT
AAGAAAGATGGTGCTGACTTTGGGAAGTGGCGTGCTGTGCTGAAGATTGACAACCAGTGT
CCATCCCATCTTGCTATCCAGGAAAACGCCAACACCCTCGCCCGCTATGCCAGCATCTGT
CAGCAGAATGGTCTGGTACCCATTGTTGAGCCAGAGGTAATTCCTGATGGCAGCCATGAC
ATGGAACACTGCCAGTATGTTACTGAGAAGGTCCTGGCTGCTGTATACAAGGCCCTGAAT
GACCATCACGTTTACTTGGAGGGCACCCTGTTGAAGCCCAACATGGTGACTGCTGGACAT
GCCTGCACCAAGAAGTATACTCCAGAGCAGGTGGCAATGGCCACAGTTACAGCTCTCCAC
CGTACTGTTCCTGCAGCTGTTCCTGGCATCTGCTTTTTGTCTGGTGGCATGAGTGAAGAG
GATGCTACTCTCAACCTCAATGCTATCAACCTTTGCCCTCTACCAAAGCCCTGGAAACTA
AGTTTCTCTTATGGACGGGCCCTGCAGGCCAGTGCACTGGCTGCGTGGGGTGGCAAGGCT
GAAAACAAGAAGGCAACCCAGGAGGCCTTTATGAAGCGGGCCCTGGCTAACAGCCAGGCA
GCCAAAGGACAGTATGTTCACATGGGCTCTTCTGGCTCTGCTTCCACCCAGTCGCTCTTC
ACTGCCAGCTATACCTACTAGAACCCGAGGCTGACCAGCTTGGCTCTGGCGCTCTAGGTG
TCTTGGTAGGAGGGCTAAAAGGAAACAACGACTTTTCGACTGACCCTGGAAATTAGATGA
AATTAGGTTGCAAGCTACTGGAAACACAACACATGTTAATTTCTTAGACACAAGTGGAAA
AAAATCAGTTATGGAAACAAGTCTGAATATCAGGGATCTGATGAAATCTCACCCAATGGT
TTCTAGCTCCCCACACCCCAAAGAGTCTATCTAAGAAAAGAACAGACTTTAAAACAGAAC
CAGCTCTCCATCCAGATCACCAAATGAAATACCTCCCAAGCTGAGTGCAGAGAAGCGCAT
CTTATTAAACAGTTTTAGCAGTGGTAGGTTATGAAGGAGACAGCTGCAACCAGAAAATGA
AATAAAATGTTCTACAAACCTTCAAAAAAAAAAAAAAAA
>gi|148745535|gb|AAI42386.1| ALDOB protein [Bos taurus]
MAHQFPALTSEQKKALSETARRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR
ELLFTVDSSISQSIGGVILFHETLYQKDGQGKLFRDILKEKGIVVGIKLDQGVAPLAGTN
KETTVQGLDGLSERCAQYKKDGADFGKWRAVLKIDNQCPSHLAIQENANTLARYASICQQ
NGLVPIVEPEVIPDGSHDMEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHAC
TKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSF
SYGRALQASALAAWGGKAENKKATQEAFMKRALANSQAAKGQYVHMGSSGSASTQSLFTA
SYTY
 
 
LifeFormulae, LLC ©    Home  |  Contact Us  |  Site Map  |  Privacy Policy | LifeFormulae Blog